| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341266.1 | internal | 206 | 3-620(+) |
Amino Acid sequence : | |||
| WYIPLLGFDTSSRTLEIRADLLNMTRLMLFQTKASSSLPTTSISTEAPGREIPTFGAIAPESCAKDFFDRVPNLKRLGVRGKLTLLLDLNNESLDGLRKLSNLEKLKLLNDVFPAPPSEA RLCGLPPASKFPPNLKILTLSRTSLNWRHMSILGSLENLVVLKVKDKAFLGDTWVTDGGFCKLEVLRIERTNLKRWLACDHHFPNL | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 23,112.738 | ||
| Theoretical pI: | 9.414 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
| Instability index: | 44.589 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.252 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341266.1 | internal | 206 | 3-620(+) |
Amino Acid sequence : | |||
| WYIPLLGFDTSSRTLEIRADLLNMTRLMLFQTKASSSLPTTSISTEAPGREIPTFGAIAPESCAKDFFDRVPNLKRLGVRGKLTLLLDLNNESLDGLRKLSNLEKLKLLNDVFPAPPSEA RLCGLPPASKFPPNLKILTLSRTSLNWRHMSILGSLENLVVLKVKDKAFLGDTWVTDGGFCKLEVLRIERTNLKRWLACDHHFPNL | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 23,112.738 | ||
| Theoretical pI: | 9.414 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
| Instability index: | 44.589 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.252 | ||
| sheet | 0.301 | ||