| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341290.1 | 5prime_partial | 184 | 564-10(-) |
Amino Acid sequence : | |||
| HEASCRIRHEAEKYLDEKTIFHLNPSGRFVIGGPPGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGVPEPLSVFVDSYGTGKIP AKEILKIVKENFDFRPGKISINLDLKRGGNGRFLKTAAYGPFGRDDGEFSWEVGKPLKWDNPQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,934.455 | ||
| Theoretical pI: | 9.438 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 18.466 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.288 | ||
| sheet | 0.185 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341290.1 | 5prime_partial | 184 | 564-10(-) |
Amino Acid sequence : | |||
| HEASCRIRHEAEKYLDEKTIFHLNPSGRFVIGGPPGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGVPEPLSVFVDSYGTGKIP AKEILKIVKENFDFRPGKISINLDLKRGGNGRFLKTAAYGPFGRDDGEFSWEVGKPLKWDNPQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,934.455 | ||
| Theoretical pI: | 9.438 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 18.466 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.288 | ||
| sheet | 0.185 | ||