| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341295.1 | internal | 201 | 604-2(-) |
Amino Acid sequence : | |||
| GLSGEAFKTGTPLYLKSIRGEDSWNDPPYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKA DAVMLMWVLHDWSDDKCIAILKKCKEAIPPSTGKVMLVDAIINESGEGVEYSGARLSLDMTMMAMPTQGNERSYNELGASV | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 21,654.630 | ||
| Theoretical pI: | 5.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 14.598 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.259 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341295.1 | internal | 201 | 604-2(-) |
Amino Acid sequence : | |||
| GLSGEAFKTGTPLYLKSIRGEDSWNDPPYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKA DAVMLMWVLHDWSDDKCIAILKKCKEAIPPSTGKVMLVDAIINESGEGVEYSGARLSLDMTMMAMPTQGNERSYNELGASV | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 21,654.630 | ||
| Theoretical pI: | 5.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 14.598 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.259 | ||
| sheet | 0.289 | ||