| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341307.1 | 5prime_partial | 230 | 758-66(-) |
Amino Acid sequence : | |||
| ILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSSIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGL IGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPKEITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSDITALFVDPIII* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 26,808.275 | ||
| Theoretical pI: | 5.142 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 53985 | ||
| Instability index: | 34.480 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.451 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.213 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341307.1 | 5prime_partial | 230 | 758-66(-) |
Amino Acid sequence : | |||
| ILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSSIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGL IGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPKEITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSDITALFVDPIII* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 26,808.275 | ||
| Theoretical pI: | 5.142 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 53985 | ||
| Instability index: | 34.480 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.451 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.213 | ||
| sheet | 0.230 | ||