| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341314.1 | internal | 205 | 617-3(-) |
Amino Acid sequence : | |||
| PYMLMQGTPVTSSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHVRLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKG VDFVGGDIFESLPKAAAVMLMWVLHDWRDDKCIEIFKKCKEAIPTSTGKVMIVDGLIHEEGEGVEYSGARLSLDMTMMVKPTQGK | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 22,171.436 | ||
| Theoretical pI: | 6.244 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 16.952 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.239 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341314.1 | internal | 205 | 617-3(-) |
Amino Acid sequence : | |||
| PYMLMQGTPVTSSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHVRLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKG VDFVGGDIFESLPKAAAVMLMWVLHDWRDDKCIEIFKKCKEAIPTSTGKVMIVDGLIHEEGEGVEYSGARLSLDMTMMVKPTQGK | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 22,171.436 | ||
| Theoretical pI: | 6.244 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 16.952 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.239 | ||
| sheet | 0.273 | ||