| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341317.1 | internal | 220 | 3-662(+) |
Amino Acid sequence : | |||
| PENPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRS VRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIQDPDKLKVIASNPM | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 24,517.885 | ||
| Theoretical pI: | 5.159 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 40910 | ||
| Instability index: | 38.525 | ||
| aromaticity | 0.145 | ||
| GRAVY | -0.087 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.282 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341317.1 | internal | 220 | 3-662(+) |
Amino Acid sequence : | |||
| PENPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRS VRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIQDPDKLKVIASNPM | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 24,517.885 | ||
| Theoretical pI: | 5.159 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 40910 | ||
| Instability index: | 38.525 | ||
| aromaticity | 0.145 | ||
| GRAVY | -0.087 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.282 | ||
| sheet | 0.264 | ||