| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341320.1 | 5prime_partial | 236 | 1-711(+) |
Amino Acid sequence : | |||
| ARRLRYRWFYRQRFIAPTELYKYILDTSVYPREEECLKELRALTWTHPRAVMGTAPETGQFMALLLKTINAKKTLEIGVFTGYSLLLTALAIPHDGKITAIDINRDTYEIGLPIIEKAGV KHKIDFIESKALPALDHLLKDGENKESFDFVFVDADKVNYANYHERVLELLRPGGIVVYDNTLWGGTVAMAPDLVAESKLQYRNAAVEFNNFIAADSRVQISQLPVGDGITVCRRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 13,536.717 | ||
| Theoretical pI: | 9.759 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 30.992 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.052 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.200 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341320.1 | complete | 115 | 759-412(-) |
Amino Acid sequence : | |||
| MLRKEWNFHFITTYTLSLAATNSNPITHRELRNLNTRVCSNEVVKLHCSIPVLELALRHQIRRHRNGASPQCVVINNYSTWPQKLQHPFMVVCIVHFISIHKHEVKTLFILPIFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,536.717 | ||
| Theoretical pI: | 9.759 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 30.992 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.052 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.200 | ||
| sheet | 0.209 | ||