| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341338.1 | 5prime_partial | 155 | 1-468(+) |
Amino Acid sequence : | |||
| AFPGLEMAVQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGHNPTEAELHDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLG EKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,464.253 | ||
| Theoretical pI: | 4.219 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 23.933 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.523 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.168 | ||
| sheet | 0.335 | ||