| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341357.1 | 5prime_partial | 221 | 1-666(+) |
Amino Acid sequence : | |||
| FISTLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVLD GYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP* | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 12,512.639 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 91.290 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.669 | ||
Secondary Structure Fraction | |||
| Helix | 0.071 | ||
| turn | 0.465 | ||
| sheet | 0.213 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341357.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
| SSPLSSLSSSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPSWT ATICRWR* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 12,512.639 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 91.290 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.669 | ||
Secondary Structure Fraction | |||
| Helix | 0.071 | ||
| turn | 0.465 | ||
| sheet | 0.213 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341357.1 | 5prime_partial | 221 | 1-666(+) |
Amino Acid sequence : | |||
| FISTLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVLD GYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP* | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 12,512.639 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 91.290 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.669 | ||
Secondary Structure Fraction | |||
| Helix | 0.071 | ||
| turn | 0.465 | ||
| sheet | 0.213 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341357.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
| SSPLSSLSSSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPSWT ATICRWR* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 12,512.639 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 91.290 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.669 | ||
Secondary Structure Fraction | |||
| Helix | 0.071 | ||
| turn | 0.465 | ||
| sheet | 0.213 | ||