| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341370.1 | internal | 178 | 3-536(+) |
Amino Acid sequence : | |||
| RFPSFMEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMA AHARLTAAAIVTNYPTAFNGVRSVVDVGGRHRMAIGKLVEAFPWVRGIAFDLPEVVAD | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,560.259 | ||
| Theoretical pI: | 9.035 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 32.988 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.264 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341370.1 | internal | 178 | 3-536(+) |
Amino Acid sequence : | |||
| RFPSFMEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMA AHARLTAAAIVTNYPTAFNGVRSVVDVGGRHRMAIGKLVEAFPWVRGIAFDLPEVVAD | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,560.259 | ||
| Theoretical pI: | 9.035 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 32.988 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.264 | ||
| sheet | 0.287 | ||