| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341389.1 | internal | 142 | 1-426(+) |
Amino Acid sequence : | |||
| HLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSHAIGVAEPLSVFVHTYNTGKIPDKDILALIKENFYFRPGMIAI NLDLKRGGNFRYHNTAAYGHFG | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,147.095 | ||
| Theoretical pI: | 9.882 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 12.813 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.289 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341389.1 | internal | 142 | 1-426(+) |
Amino Acid sequence : | |||
| HLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSHAIGVAEPLSVFVHTYNTGKIPDKDILALIKENFYFRPGMIAI NLDLKRGGNFRYHNTAAYGHFG | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,147.095 | ||
| Theoretical pI: | 9.882 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 12.813 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.289 | ||
| sheet | 0.176 | ||