| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341393.1 | 5prime_partial | 217 | 782-129(-) |
Amino Acid sequence : | |||
| SRLGTHELLPLINKVILEQLQSHLLHLLAHFEVASQKRPQNRDEIAIVVLKALRQSTPLSIQRLQFQKQRIVLALEPSIEHNPVHIVVHHQLQAPPQHDSVRCRLRIPLHIIHHGGSLRL PPVPVLLHHLVGEERHRHDPPHLPPVLAVDGEHHVLPLTGENVEHNIARARSELHPLRVEHLLRVLRRRDDDEVALPHAEEEYLAESLRVIGEIAVV* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 23,498.951 | ||
| Theoretical pI: | 9.760 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
| Instability index: | 42.982 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.474 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.177 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341393.1 | 3prime_partial | 198 | 189-782(+) |
Amino Acid sequence : | |||
| MGQRNLVVVSSPEHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEAEAAAVVDDVKRNPESATNGIVLRRRLQLMMYNNMYRIMFD RRFESEDDPLFLKLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKMCQQVKEMRLQLFKDYFVDERKKLVSTKPA | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 23,498.951 | ||
| Theoretical pI: | 9.760 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
| Instability index: | 42.982 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.474 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.177 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341393.1 | 5prime_partial | 217 | 782-129(-) |
Amino Acid sequence : | |||
| SRLGTHELLPLINKVILEQLQSHLLHLLAHFEVASQKRPQNRDEIAIVVLKALRQSTPLSIQRLQFQKQRIVLALEPSIEHNPVHIVVHHQLQAPPQHDSVRCRLRIPLHIIHHGGSLRL PPVPVLLHHLVGEERHRHDPPHLPPVLAVDGEHHVLPLTGENVEHNIARARSELHPLRVEHLLRVLRRRDDDEVALPHAEEEYLAESLRVIGEIAVV* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 23,498.951 | ||
| Theoretical pI: | 9.760 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
| Instability index: | 42.982 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.474 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.177 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341393.1 | 3prime_partial | 198 | 189-782(+) |
Amino Acid sequence : | |||
| MGQRNLVVVSSPEHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEAEAAAVVDDVKRNPESATNGIVLRRRLQLMMYNNMYRIMFD RRFESEDDPLFLKLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKMCQQVKEMRLQLFKDYFVDERKKLVSTKPA | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 23,498.951 | ||
| Theoretical pI: | 9.760 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
| Instability index: | 42.982 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.474 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.177 | ||
| sheet | 0.242 | ||