Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341399.1 | 5prime_partial | 160 | 2-484(+) |
Amino Acid sequence : | |||
HACNNHALCALRHPFPLSLLSTSLEMASVTAPTVNFSSVSCLVKQNQASNLKKTSLSFSGKAFQSRRLPALRFRVACAAKPETVDKVVDIVRKQLALAEDRVVNGESKFSTLGADSLDTV EIVMGLEEEFGICVEEESAQSISTVQEAADLIETLLEKKC* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,326.664 | ||
Theoretical pI: | 5.653 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
Instability index: | 49.463 | ||
aromaticity | 0.044 | ||
GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.213 | ||
sheet | 0.325 |