| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341399.1 | 5prime_partial | 160 | 2-484(+) |
Amino Acid sequence : | |||
| HACNNHALCALRHPFPLSLLSTSLEMASVTAPTVNFSSVSCLVKQNQASNLKKTSLSFSGKAFQSRRLPALRFRVACAAKPETVDKVVDIVRKQLALAEDRVVNGESKFSTLGADSLDTV EIVMGLEEEFGICVEEESAQSISTVQEAADLIETLLEKKC* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,326.664 | ||
| Theoretical pI: | 5.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
| Instability index: | 49.463 | ||
| aromaticity | 0.044 | ||
| GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.213 | ||
| sheet | 0.325 | ||