| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341405.1 | internal | 100 | 301-2(-) |
Amino Acid sequence : | |||
| TRVKLPHLIRAVRRAGQIVTCVCDPMHGNTIKAPCGLKTRAFDAILAEVRAFFDVHEQEGSHAGGIHLEMTGQNVTEGIGGSRPVTYDVLKARYHTHCDP | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,945.443 | ||
| Theoretical pI: | 8.451 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 35.894 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.190 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341405.1 | internal | 100 | 301-2(-) |
Amino Acid sequence : | |||
| TRVKLPHLIRAVRRAGQIVTCVCDPMHGNTIKAPCGLKTRAFDAILAEVRAFFDVHEQEGSHAGGIHLEMTGQNVTEGIGGSRPVTYDVLKARYHTHCDP | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,945.443 | ||
| Theoretical pI: | 8.451 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 35.894 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.190 | ||
| sheet | 0.220 | ||