| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341416.1 | internal | 223 | 3-671(+) |
Amino Acid sequence : | |||
| TPVKVCVTGGTGFLGPWMIKRLLEDGYSVNATIRLHPERNRDISYITNLPGAAERLQIFNADLDNPETFVPAIKGCSGVFHMAHPLDFAEKESEEVKLKRVTAGLQGILQACADSNTVRR VVYTSSISAAAFGSPTNSDGLVDENSWTDVDLIRSLKTFGGPYIVTKTLTEKAAIDLGEKLGLDLVTVVPTWTHGPFICPNFPDSVYVAMALILGDESHYQHL | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 20,685.950 | ||
| Theoretical pI: | 11.770 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 91.914 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.525 | ||
Secondary Structure Fraction | |||
| Helix | 0.166 | ||
| turn | 0.234 | ||
| sheet | 0.189 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341416.1 | 5prime_partial | 175 | 2-529(+) |
Amino Acid sequence : | |||
| HARKSVCDWRNRVSWTVDDQETLGRWLLCQRHNKTSSRAEQGHQLHHQPPRRGGATADLQRRPRQSGDIRASDKRMQRRLPHGSPSRLRRERIGGSKAEASHRRLTRHPAGLRRFQHCPP RGLHFQHLRRSLRLPHKLRRPRRREFVDRRGSDPQPEDLRRAVHRDENVDGESGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 20,685.950 | ||
| Theoretical pI: | 11.770 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 91.914 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.525 | ||
Secondary Structure Fraction | |||
| Helix | 0.166 | ||
| turn | 0.234 | ||
| sheet | 0.189 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341416.1 | internal | 223 | 3-671(+) |
Amino Acid sequence : | |||
| TPVKVCVTGGTGFLGPWMIKRLLEDGYSVNATIRLHPERNRDISYITNLPGAAERLQIFNADLDNPETFVPAIKGCSGVFHMAHPLDFAEKESEEVKLKRVTAGLQGILQACADSNTVRR VVYTSSISAAAFGSPTNSDGLVDENSWTDVDLIRSLKTFGGPYIVTKTLTEKAAIDLGEKLGLDLVTVVPTWTHGPFICPNFPDSVYVAMALILGDESHYQHL | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 20,685.950 | ||
| Theoretical pI: | 11.770 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 91.914 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.525 | ||
Secondary Structure Fraction | |||
| Helix | 0.166 | ||
| turn | 0.234 | ||
| sheet | 0.189 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341416.1 | 5prime_partial | 175 | 2-529(+) |
Amino Acid sequence : | |||
| HARKSVCDWRNRVSWTVDDQETLGRWLLCQRHNKTSSRAEQGHQLHHQPPRRGGATADLQRRPRQSGDIRASDKRMQRRLPHGSPSRLRRERIGGSKAEASHRRLTRHPAGLRRFQHCPP RGLHFQHLRRSLRLPHKLRRPRRREFVDRRGSDPQPEDLRRAVHRDENVDGESGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 20,685.950 | ||
| Theoretical pI: | 11.770 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 91.914 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.525 | ||
Secondary Structure Fraction | |||
| Helix | 0.166 | ||
| turn | 0.234 | ||
| sheet | 0.189 | ||