Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341428.1 | 5prime_partial | 171 | 2-517(+) |
Amino Acid sequence : | |||
HAFRVDPAKGGRPDFPFKDGAYPEQVDWIGQKNQIDAAKVAGVKHIVLVGSMGGTNPDHPLNSLANGNILIWKRKAEQYLADSGIPYTIIRAGGLQDREGGLRELLVGKDDELLKTETRT IPRADVAEVCIQALNFEEAKFKAFDLASKPEGSGTPTTDFKALFSQITARF* | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 18,664.927 | ||
Theoretical pI: | 6.358 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 20.948 | ||
aromaticity | 0.082 | ||
GRAVY | -0.374 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.228 | ||
sheet | 0.251 |