| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341431.1 | 3prime_partial | 196 | 191-778(+) |
Amino Acid sequence : | |||
| MVPFAGWSMPIQYKDSIMDSTLNCRQNGSLFDVAHMCGLSLKGKDCIPFLEKLVIADVAGLANGTGTLTVFTNEKGGAIDDSVITKVTDQHIYIVVNAGCRDKDLAHIEEHMKAFTAKGG DVSWHIHDERSLLALQGPLAAPTLQHLTKDDLSKMYFSDFRILDINGVSCFLTRTGYTGEDGFEISVPLRARGRSC | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 16,437.609 | ||
| Theoretical pI: | 9.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 64.370 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.248 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341431.1 | complete | 149 | 463-14(-) |
Amino Acid sequence : | |||
| MLISHLSDHRIVNSTAFLIRKHGQSPSPIRKTGHISNHELLKKGDAVFSFQAQTTHMCDIKEAAILPAVQSRVHNRVLVLNRHAPARERDHLPTIGDVEVVQSCLLEVSLGCEASTSNCL LVSVGQSAGNRLTELPQSRSPHISKYHKD* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,437.609 | ||
| Theoretical pI: | 9.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 64.370 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.248 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341431.1 | 3prime_partial | 196 | 191-778(+) |
Amino Acid sequence : | |||
| MVPFAGWSMPIQYKDSIMDSTLNCRQNGSLFDVAHMCGLSLKGKDCIPFLEKLVIADVAGLANGTGTLTVFTNEKGGAIDDSVITKVTDQHIYIVVNAGCRDKDLAHIEEHMKAFTAKGG DVSWHIHDERSLLALQGPLAAPTLQHLTKDDLSKMYFSDFRILDINGVSCFLTRTGYTGEDGFEISVPLRARGRSC | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 16,437.609 | ||
| Theoretical pI: | 9.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 64.370 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.248 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341431.1 | complete | 149 | 463-14(-) |
Amino Acid sequence : | |||
| MLISHLSDHRIVNSTAFLIRKHGQSPSPIRKTGHISNHELLKKGDAVFSFQAQTTHMCDIKEAAILPAVQSRVHNRVLVLNRHAPARERDHLPTIGDVEVVQSCLLEVSLGCEASTSNCL LVSVGQSAGNRLTELPQSRSPHISKYHKD* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,437.609 | ||
| Theoretical pI: | 9.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 64.370 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.248 | ||
| sheet | 0.235 | ||