| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341432.1 | internal | 207 | 621-1(-) |
Amino Acid sequence : | |||
| KDDLSKMYFSDFRILDINGVSCFLTRTGYTGEDGFEMSVPSEHAVDLAKALLDKSEGKVRLTGLGARDSLGLEAGICLCGNDMEQHTTPVEAGLTWAIGKRRRAEGGFLGAEVILKQIAD GPPVRRVGIFSLGPPARSHSEIQNEKGEAIGEVTSGGFSPCLKKNIAMGYEKSGCLKNGTKLKIVVRGKTYDGTISKMPLVLTNYYK | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 19,979.924 | ||
| Theoretical pI: | 11.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 115.985 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.717 | ||
Secondary Structure Fraction | |||
| Helix | 0.147 | ||
| turn | 0.294 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341432.1 | 3prime_partial | 195 | 38-622(+) |
Amino Acid sequence : | |||
| MVPSYVFPLTTIFNFVPFLRHPDFSYPMAMFFFKHGLNPPLVTSPIASPFSFWISLWLLAGGPKEKIPTLLTGGPSAICFRITSAPRNPPSALLLFPMAHVSPASTGVVCCSMSFPQRHM PASRPRLSRAPRPVRRTLPSDLSRRAFARSTACSEGTDISKPSSPVYPVLVRKHETPLISNMRKSLKYILLKSSF | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 19,979.924 | ||
| Theoretical pI: | 11.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 115.985 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.717 | ||
Secondary Structure Fraction | |||
| Helix | 0.147 | ||
| turn | 0.294 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341432.1 | 5prime_partial | 170 | 622-110(-) |
Amino Acid sequence : | |||
| ERRFEQNVLQRLPHIGYQRGLVLPHKNGVHRRRRFRDVSPLGARGRSCKSPSRQIRRQSPPNRSRRPRQSRPRSRHMPLRERHGATHNTSGSRAHVGHREEKEGRGRVPWGRSDPEADRR RPAREESRDLLFGPAREEPQRDPEREGGGDRRSDERRVQPVLEEEHSHGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,979.924 | ||
| Theoretical pI: | 11.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 115.985 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.717 | ||
Secondary Structure Fraction | |||
| Helix | 0.147 | ||
| turn | 0.294 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341432.1 | internal | 207 | 621-1(-) |
Amino Acid sequence : | |||
| KDDLSKMYFSDFRILDINGVSCFLTRTGYTGEDGFEMSVPSEHAVDLAKALLDKSEGKVRLTGLGARDSLGLEAGICLCGNDMEQHTTPVEAGLTWAIGKRRRAEGGFLGAEVILKQIAD GPPVRRVGIFSLGPPARSHSEIQNEKGEAIGEVTSGGFSPCLKKNIAMGYEKSGCLKNGTKLKIVVRGKTYDGTISKMPLVLTNYYK | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 19,979.924 | ||
| Theoretical pI: | 11.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 115.985 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.717 | ||
Secondary Structure Fraction | |||
| Helix | 0.147 | ||
| turn | 0.294 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341432.1 | 3prime_partial | 195 | 38-622(+) |
Amino Acid sequence : | |||
| MVPSYVFPLTTIFNFVPFLRHPDFSYPMAMFFFKHGLNPPLVTSPIASPFSFWISLWLLAGGPKEKIPTLLTGGPSAICFRITSAPRNPPSALLLFPMAHVSPASTGVVCCSMSFPQRHM PASRPRLSRAPRPVRRTLPSDLSRRAFARSTACSEGTDISKPSSPVYPVLVRKHETPLISNMRKSLKYILLKSSF | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 19,979.924 | ||
| Theoretical pI: | 11.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 115.985 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.717 | ||
Secondary Structure Fraction | |||
| Helix | 0.147 | ||
| turn | 0.294 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341432.1 | 5prime_partial | 170 | 622-110(-) |
Amino Acid sequence : | |||
| ERRFEQNVLQRLPHIGYQRGLVLPHKNGVHRRRRFRDVSPLGARGRSCKSPSRQIRRQSPPNRSRRPRQSRPRSRHMPLRERHGATHNTSGSRAHVGHREEKEGRGRVPWGRSDPEADRR RPAREESRDLLFGPAREEPQRDPEREGGGDRRSDERRVQPVLEEEHSHGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,979.924 | ||
| Theoretical pI: | 11.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 115.985 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.717 | ||
Secondary Structure Fraction | |||
| Helix | 0.147 | ||
| turn | 0.294 | ||
| sheet | 0.194 | ||