Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341446.1 | 5prime_partial | 140 | 662-240(-) |
Amino Acid sequence : | |||
LLQSHCKITLRNINCWDPEGHSSQLSIQSRENFANSLCSFGATWDNIERCSSSAPPVLGRWSINSLLSCSNRVDCCHKTLDNTNPIIDNLSQWGKAVCGTTSIGHNIQVRCVCLSLTRTT NMGASFLGAEMMTFFAPPFR* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,455.444 | ||
Theoretical pI: | 8.126 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22625 | ||
Instability index: | 54.922 | ||
aromaticity | 0.071 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.314 | ||
sheet | 0.193 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341446.1 | 5prime_partial | 140 | 662-240(-) |
Amino Acid sequence : | |||
LLQSHCKITLRNINCWDPEGHSSQLSIQSRENFANSLCSFGATWDNIERCSSSAPPVLGRWSINSLLSCSNRVDCCHKTLDNTNPIIDNLSQWGKAVCGTTSIGHNIQVRCVCLSLTRTT NMGASFLGAEMMTFFAPPFR* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,455.444 | ||
Theoretical pI: | 8.126 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22625 | ||
Instability index: | 54.922 | ||
aromaticity | 0.071 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.314 | ||
sheet | 0.193 |