Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341454.1 | complete | 204 | 683-69(-) |
Amino Acid sequence : | |||
MDPNRDPDKVVDETCWSDLEFCKSTKNWYCYGKAVAEQAAWETAREVGVDLVVLKPVLVLGSLLQPTVNASVLHILKYLIGSAKTYANSIQAYVDVKDVALAHILLFENPAASGRYLCTE SVLHRGEVVEILAKLFPEYPIPTKCSDEKSPRTKPYKFSNQKLKDLGIEFTPVKQSLYDTVKSLREKGHLPIPNQNEEPISIQS* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 11,259.771 | ||
Theoretical pI: | 10.922 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 30.700 | ||
aromaticity | 0.162 | ||
GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.313 | ||
sheet | 0.182 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341454.1 | complete | 99 | 109-408(+) |
Amino Acid sequence : | |||
MGRCPFSRRLFTVSYKLCFTGVNSIPKSFSFWFENLYGFVLGLFSSEHLVGIGYSGNNLARISTTSPRWRTLSVQRYRPDAAGFSNKRMWARATSLTST* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,259.771 | ||
Theoretical pI: | 10.922 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 30.700 | ||
aromaticity | 0.162 | ||
GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.313 | ||
sheet | 0.182 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341454.1 | complete | 204 | 683-69(-) |
Amino Acid sequence : | |||
MDPNRDPDKVVDETCWSDLEFCKSTKNWYCYGKAVAEQAAWETAREVGVDLVVLKPVLVLGSLLQPTVNASVLHILKYLIGSAKTYANSIQAYVDVKDVALAHILLFENPAASGRYLCTE SVLHRGEVVEILAKLFPEYPIPTKCSDEKSPRTKPYKFSNQKLKDLGIEFTPVKQSLYDTVKSLREKGHLPIPNQNEEPISIQS* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 11,259.771 | ||
Theoretical pI: | 10.922 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 30.700 | ||
aromaticity | 0.162 | ||
GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.313 | ||
sheet | 0.182 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341454.1 | complete | 99 | 109-408(+) |
Amino Acid sequence : | |||
MGRCPFSRRLFTVSYKLCFTGVNSIPKSFSFWFENLYGFVLGLFSSEHLVGIGYSGNNLARISTTSPRWRTLSVQRYRPDAAGFSNKRMWARATSLTST* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,259.771 | ||
Theoretical pI: | 10.922 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 30.700 | ||
aromaticity | 0.162 | ||
GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.313 | ||
sheet | 0.182 |