Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341489.1 | 5prime_partial | 162 | 3-491(+) |
Amino Acid sequence : | |||
VTMKKAKSSKRQNTFYHVITIPIRALCKARDFYVRNMLDCANSNAIGLQATAQTSSLPRSFSAASSRSYNDDRDDYRDLVRAASARSIGVRLDVEAYLKQERIRAGPKRSASVAMGRIDE ERASNYFGEDVKNGGEIVGNNRKNSDLKYPRSKSDVVTRTSF* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 11,625.820 | ||
Theoretical pI: | 10.967 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 95.555 | ||
aromaticity | 0.080 | ||
GRAVY | -1.248 | ||
Secondary Structure Fraction | |||
Helix | 0.130 | ||
turn | 0.360 | ||
sheet | 0.130 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341489.1 | 5prime_partial | 119 | 2-361(+) |
Amino Acid sequence : | |||
GNDEESKIKQTTKHLLSRDHNSYSGPVQGPRFLREEHVGLREFQRDRAAGHGADFEPAPQLQRGLIAVVQRRPRRLPRSRSGRLGPEHRGSARCRGVLETGEDSGRAEEKRERCDGQNR* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 11,625.820 | ||
Theoretical pI: | 10.967 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 95.555 | ||
aromaticity | 0.080 | ||
GRAVY | -1.248 | ||
Secondary Structure Fraction | |||
Helix | 0.130 | ||
turn | 0.360 | ||
sheet | 0.130 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341489.1 | complete | 100 | 486-184(-) |
Amino Acid sequence : | |||
MMFLSQHHFCFLDTSNHYSSYYCQQSHPHSSHLHQSNCSPSPHRFCPSQRSRFSSARPESSPVSSTPRHRAEPRCSGPRRPERDLGSRRGRRCTTAMRPR* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,625.820 | ||
Theoretical pI: | 10.967 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 95.555 | ||
aromaticity | 0.080 | ||
GRAVY | -1.248 | ||
Secondary Structure Fraction | |||
Helix | 0.130 | ||
turn | 0.360 | ||
sheet | 0.130 |