Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341490.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
FSSSILWEMARKKIREYDSKRLLKEHLKRLSGIDLQIRSAQVTESTDFAELTNKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAQVAAFVKERLGVEVEMGGCKAPITTFIVEPFVP HDQEYYLSIVSERLGNTISFSECGGIEIEENWDKVKTVFLPTEKSMNLEACAPLIATLPLEVRGKIGEFINGVFSVFQDLDFSFLEMNPFTLVNGEPYPLDMRGELDDTAAFKNFKKWGD IEFPLPFGRVLSPT | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 28,664.705 | ||
Theoretical pI: | 5.122 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 39.258 | ||
aromaticity | 0.102 | ||
GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.228 | ||
sheet | 0.283 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341490.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
FSSSILWEMARKKIREYDSKRLLKEHLKRLSGIDLQIRSAQVTESTDFAELTNKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAQVAAFVKERLGVEVEMGGCKAPITTFIVEPFVP HDQEYYLSIVSERLGNTISFSECGGIEIEENWDKVKTVFLPTEKSMNLEACAPLIATLPLEVRGKIGEFINGVFSVFQDLDFSFLEMNPFTLVNGEPYPLDMRGELDDTAAFKNFKKWGD IEFPLPFGRVLSPT | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 28,664.705 | ||
Theoretical pI: | 5.122 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 39.258 | ||
aromaticity | 0.102 | ||
GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.228 | ||
sheet | 0.283 |