| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341490.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
| FSSSILWEMARKKIREYDSKRLLKEHLKRLSGIDLQIRSAQVTESTDFAELTNKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAQVAAFVKERLGVEVEMGGCKAPITTFIVEPFVP HDQEYYLSIVSERLGNTISFSECGGIEIEENWDKVKTVFLPTEKSMNLEACAPLIATLPLEVRGKIGEFINGVFSVFQDLDFSFLEMNPFTLVNGEPYPLDMRGELDDTAAFKNFKKWGD IEFPLPFGRVLSPT | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 28,664.705 | ||
| Theoretical pI: | 5.122 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 39.258 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.228 | ||
| sheet | 0.283 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341490.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
| FSSSILWEMARKKIREYDSKRLLKEHLKRLSGIDLQIRSAQVTESTDFAELTNKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAQVAAFVKERLGVEVEMGGCKAPITTFIVEPFVP HDQEYYLSIVSERLGNTISFSECGGIEIEENWDKVKTVFLPTEKSMNLEACAPLIATLPLEVRGKIGEFINGVFSVFQDLDFSFLEMNPFTLVNGEPYPLDMRGELDDTAAFKNFKKWGD IEFPLPFGRVLSPT | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 28,664.705 | ||
| Theoretical pI: | 5.122 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 39.258 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.228 | ||
| sheet | 0.283 | ||