| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341496.1 | complete | 160 | 63-545(+) |
Amino Acid sequence : | |||
| MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD ENLLNQIKSGFEEGKDLVVSVQSAMGEEQICALKDIGPKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 11,941.264 | ||
| Theoretical pI: | 11.741 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 46.020 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.255 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341496.1 | 5prime_partial | 106 | 1-321(+) |
Amino Acid sequence : | |||
| FSQKSRELIVAIKSKKKPRERCRTRSITLNPRPTPALPRLTLSKPALFAKMVTLSSKTGLARLLKSPPQKLESTVMPNVTLWGSIFSTERSSKILFLPLTTVMFLM* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,941.264 | ||
| Theoretical pI: | 11.741 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 46.020 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.255 | ||
| sheet | 0.274 | ||