Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341496.1 | complete | 160 | 63-545(+) |
Amino Acid sequence : | |||
MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD ENLLNQIKSGFEEGKDLVVSVQSAMGEEQICALKDIGPKN* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 11,941.264 | ||
Theoretical pI: | 11.741 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 46.020 | ||
aromaticity | 0.057 | ||
GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.255 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341496.1 | 5prime_partial | 106 | 1-321(+) |
Amino Acid sequence : | |||
FSQKSRELIVAIKSKKKPRERCRTRSITLNPRPTPALPRLTLSKPALFAKMVTLSSKTGLARLLKSPPQKLESTVMPNVTLWGSIFSTERSSKILFLPLTTVMFLM* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,941.264 | ||
Theoretical pI: | 11.741 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 46.020 | ||
aromaticity | 0.057 | ||
GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.255 | ||
sheet | 0.274 |