| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341498.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| YIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTF PLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAGVVDG RNIWANDLAASIT | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 27,672.229 | ||
| Theoretical pI: | 4.895 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45840 45840 | ||
| Instability index: | 24.458 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.237 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341498.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| YIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTF PLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAGVVDG RNIWANDLAASIT | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 27,672.229 | ||
| Theoretical pI: | 4.895 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45840 45840 | ||
| Instability index: | 24.458 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.237 | ||
| sheet | 0.273 | ||