| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341501.1 | internal | 266 | 1-798(+) |
Amino Acid sequence : | |||
| ARTFRAESARGFTRTRPRISSWVSNRIFRRTASHLHKKMWTLDCTSSSAFIFNTSKESTDHPAPFSHFNGLKSLRIGSASFHVRPTPEKKNGKINAVVGRERDPKKRVVITGMGLVSVFG NDVDTFYDKLLDGVSGVGRIERFDASEFPVRIAGEIRNFSSEGYIDGKNDRRLDDCWRYCLVAGKKALHHANLTKQALATMEMSRMGVVVGSGMGGLTTISNGVENLIQRGYKTISPFCS PHTITNMGSALLAIHTGFMGPNYSIS | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 12,523.348 | ||
| Theoretical pI: | 9.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 63.458 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.486 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.222 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341501.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
| HARFVPNRHEDLLEPDQELVVGYQIEYSDARHHTFIKKCGPLTAPHLLLSSSTRVRNQQIIQLLFPTLMASNHSESVPPVSTLGQLQKRKMGRSMLLWVEKEIRRKGW* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,523.348 | ||
| Theoretical pI: | 9.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 63.458 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.486 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.222 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341501.1 | internal | 266 | 1-798(+) |
Amino Acid sequence : | |||
| ARTFRAESARGFTRTRPRISSWVSNRIFRRTASHLHKKMWTLDCTSSSAFIFNTSKESTDHPAPFSHFNGLKSLRIGSASFHVRPTPEKKNGKINAVVGRERDPKKRVVITGMGLVSVFG NDVDTFYDKLLDGVSGVGRIERFDASEFPVRIAGEIRNFSSEGYIDGKNDRRLDDCWRYCLVAGKKALHHANLTKQALATMEMSRMGVVVGSGMGGLTTISNGVENLIQRGYKTISPFCS PHTITNMGSALLAIHTGFMGPNYSIS | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 12,523.348 | ||
| Theoretical pI: | 9.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 63.458 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.486 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.222 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341501.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
| HARFVPNRHEDLLEPDQELVVGYQIEYSDARHHTFIKKCGPLTAPHLLLSSSTRVRNQQIIQLLFPTLMASNHSESVPPVSTLGQLQKRKMGRSMLLWVEKEIRRKGW* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,523.348 | ||
| Theoretical pI: | 9.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 63.458 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.486 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.222 | ||
| sheet | 0.259 | ||