| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341508.1 | internal | 263 | 3-791(+) |
Amino Acid sequence : | |||
| FVKNLSCSSLEVDPLADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQ GVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCLWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLD EKTIFHLNPSGRFVIGGPHGDAG | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 10,509.634 | ||
| Theoretical pI: | 4.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 27.874 | ||
| aromaticity | 0.010 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341508.1 | 3prime_partial | 157 | 473-3(-) |
Amino Acid sequence : | |||
| MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNTLSNIRALLLDVDKNLALVSIEANVVRDEPNRAAGVADDLLVVYVGLGCDLSKDHHHVGLGASLTSNLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRQWVDLERRTREVFDE | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 10,509.634 | ||
| Theoretical pI: | 4.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 27.874 | ||
| aromaticity | 0.010 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341508.1 | 5prime_partial | 100 | 791-489(-) |
Amino Acid sequence : | |||
| TRVAVGPTDDEPPGGIQVEDGFLVQILLGDHRLDDVLLEIPGDLVVGDGLVVLGRDEDGVDPDGDHRTVLVVVLDRDLGLPVGSQPQARTVLADLRQASA* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,509.634 | ||
| Theoretical pI: | 4.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 27.874 | ||
| aromaticity | 0.010 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341508.1 | internal | 263 | 3-791(+) |
Amino Acid sequence : | |||
| FVKNLSCSSLEVDPLADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQ GVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCLWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLD EKTIFHLNPSGRFVIGGPHGDAG | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 10,509.634 | ||
| Theoretical pI: | 4.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 27.874 | ||
| aromaticity | 0.010 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341508.1 | 3prime_partial | 157 | 473-3(-) |
Amino Acid sequence : | |||
| MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNTLSNIRALLLDVDKNLALVSIEANVVRDEPNRAAGVADDLLVVYVGLGCDLSKDHHHVGLGASLTSNLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRQWVDLERRTREVFDE | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 10,509.634 | ||
| Theoretical pI: | 4.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 27.874 | ||
| aromaticity | 0.010 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341508.1 | 5prime_partial | 100 | 791-489(-) |
Amino Acid sequence : | |||
| TRVAVGPTDDEPPGGIQVEDGFLVQILLGDHRLDDVLLEIPGDLVVGDGLVVLGRDEDGVDPDGDHRTVLVVVLDRDLGLPVGSQPQARTVLADLRQASA* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,509.634 | ||
| Theoretical pI: | 4.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 27.874 | ||
| aromaticity | 0.010 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.240 | ||