| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341520.1 | 3prime_partial | 233 | 87-785(+) |
Amino Acid sequence : | |||
| MTLLDKLVFLVVHLADKVGIAWHRLPVFLGLIYLILRRHLHEQYNLFNVGKRQAVEPAPRFDPADVPFRTSDGEFNDPEDEAAGSSGSFFGRNILPHLQNNQVRRRPDPMVVATKLLGRR KLIDTGKQFNMIAASWIQFMIHDWVDHLENLQQQVELSAPEEVASLCPLKSFKFYKSKEIEIVDGDNGIQTGFLNRRTPWWDGSAIYGSDRETLQKVRTFRDGKLKISDDGLI | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 12,835.610 | ||
| Theoretical pI: | 7.046 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 59.649 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.195 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.270 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341520.1 | 5prime_partial | 111 | 785-450(-) |
Amino Acid sequence : | |||
| NKPVVGDLQLTIPESPYFLQSFSIAPINRASIPPRRSPVQEAGLNPVITVHDFDLFRLVEFKRFERAEARNFFRSTKLNLLLKIFEMIDPIMNHELNPRSSNHVELFSSID* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,835.610 | ||
| Theoretical pI: | 7.046 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 59.649 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.195 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.270 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341520.1 | 3prime_partial | 233 | 87-785(+) |
Amino Acid sequence : | |||
| MTLLDKLVFLVVHLADKVGIAWHRLPVFLGLIYLILRRHLHEQYNLFNVGKRQAVEPAPRFDPADVPFRTSDGEFNDPEDEAAGSSGSFFGRNILPHLQNNQVRRRPDPMVVATKLLGRR KLIDTGKQFNMIAASWIQFMIHDWVDHLENLQQQVELSAPEEVASLCPLKSFKFYKSKEIEIVDGDNGIQTGFLNRRTPWWDGSAIYGSDRETLQKVRTFRDGKLKISDDGLI | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 12,835.610 | ||
| Theoretical pI: | 7.046 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 59.649 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.195 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.270 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341520.1 | 5prime_partial | 111 | 785-450(-) |
Amino Acid sequence : | |||
| NKPVVGDLQLTIPESPYFLQSFSIAPINRASIPPRRSPVQEAGLNPVITVHDFDLFRLVEFKRFERAEARNFFRSTKLNLLLKIFEMIDPIMNHELNPRSSNHVELFSSID* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,835.610 | ||
| Theoretical pI: | 7.046 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 59.649 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.195 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.270 | ||
| sheet | 0.243 | ||