| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341524.1 | 5prime_partial | 237 | 806-93(-) |
Amino Acid sequence : | |||
| NEVYVDLVEEMDATINRDGNLVKCEIYGEVQVNSNLPGLPDLTLSFANPSIFNDVRFHPCIRLRPWESSQILSFVPPDGQFKLMSYRVKKLKNTPIYVKPQFTSDSGTCRISVLVGIRSD PGKTIDSITVQFQLPPCVLSSDLSSNCGAVNVLADKTCSWTIGRMPKDKAPSMSGTLVLETGMERLQVFPTLQVGFKIMGVALSGLKIDKLDIRNPSVRPHKGFRALTKAGEFQVRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 26,207.058 | ||
| Theoretical pI: | 8.896 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
| Instability index: | 26.826 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.278 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341524.1 | 5prime_partial | 237 | 806-93(-) |
Amino Acid sequence : | |||
| NEVYVDLVEEMDATINRDGNLVKCEIYGEVQVNSNLPGLPDLTLSFANPSIFNDVRFHPCIRLRPWESSQILSFVPPDGQFKLMSYRVKKLKNTPIYVKPQFTSDSGTCRISVLVGIRSD PGKTIDSITVQFQLPPCVLSSDLSSNCGAVNVLADKTCSWTIGRMPKDKAPSMSGTLVLETGMERLQVFPTLQVGFKIMGVALSGLKIDKLDIRNPSVRPHKGFRALTKAGEFQVRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 26,207.058 | ||
| Theoretical pI: | 8.896 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
| Instability index: | 26.826 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.278 | ||
| sheet | 0.194 | ||