Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341534.1 | 5prime_partial | 176 | 2-532(+) |
Amino Acid sequence : | |||
HAVSCRIRHEDFLVVPAINMRERTIPPLPKHSCGNLVIISDEILLSSEAKKMGLQELVDLIGDSSLKRINECSGILSPDGDGRDIIINTYTKVFKQMGDPSLKSIVFSDWSKFRFYEADF GWGKPVWTSVGPMRTRTATTLLMSNKEGDGIEAWVHLDRNEMHRFEQDEEIELLAI* | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 13,588.482 | ||
Theoretical pI: | 8.772 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 68.846 | ||
aromaticity | 0.060 | ||
GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.231 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341534.1 | complete | 117 | 490-137(-) |
Amino Acid sequence : | |||
MHLVSIEMHPRLDPITLLVAHEESGGGPCPHRSHTRPHRLPPSEISFVESELTPITENYALQTRVPHLFKNFCVSINDDITPISIRRQYSTTLIYSLQRRVTYQINQLLQTHLLRLR* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,588.482 | ||
Theoretical pI: | 8.772 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 68.846 | ||
aromaticity | 0.060 | ||
GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.231 | ||
sheet | 0.222 |