Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341539.1 | internal | 176 | 1-528(+) |
Amino Acid sequence : | |||
GGSAYPRDWDYKRFGRAADNCGALLLCDMAHICGLLAAQEAADPFEYCDLVTTTTHNSLRGPRAGVIFYTKGPKPPKKGQPEDAPYDFEDKINFAVFPSLQGGPHNHQVGALAVALKQAL SPGFWAYANQVKAHAVALGNYLMSKGYSLVTGGTENHLVLWDLPPLGLAGNSLETL | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 18,888.200 | ||
Theoretical pI: | 6.304 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
Instability index: | 36.322 | ||
aromaticity | 0.102 | ||
GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.267 | ||
sheet | 0.290 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341539.1 | internal | 176 | 1-528(+) |
Amino Acid sequence : | |||
GGSAYPRDWDYKRFGRAADNCGALLLCDMAHICGLLAAQEAADPFEYCDLVTTTTHNSLRGPRAGVIFYTKGPKPPKKGQPEDAPYDFEDKINFAVFPSLQGGPHNHQVGALAVALKQAL SPGFWAYANQVKAHAVALGNYLMSKGYSLVTGGTENHLVLWDLPPLGLAGNSLETL | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 18,888.200 | ||
Theoretical pI: | 6.304 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
Instability index: | 36.322 | ||
aromaticity | 0.102 | ||
GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.267 | ||
sheet | 0.290 |