| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341539.1 | internal | 176 | 1-528(+) |
Amino Acid sequence : | |||
| GGSAYPRDWDYKRFGRAADNCGALLLCDMAHICGLLAAQEAADPFEYCDLVTTTTHNSLRGPRAGVIFYTKGPKPPKKGQPEDAPYDFEDKINFAVFPSLQGGPHNHQVGALAVALKQAL SPGFWAYANQVKAHAVALGNYLMSKGYSLVTGGTENHLVLWDLPPLGLAGNSLETL | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 18,888.200 | ||
| Theoretical pI: | 6.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
| Instability index: | 36.322 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.267 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341539.1 | internal | 176 | 1-528(+) |
Amino Acid sequence : | |||
| GGSAYPRDWDYKRFGRAADNCGALLLCDMAHICGLLAAQEAADPFEYCDLVTTTTHNSLRGPRAGVIFYTKGPKPPKKGQPEDAPYDFEDKINFAVFPSLQGGPHNHQVGALAVALKQAL SPGFWAYANQVKAHAVALGNYLMSKGYSLVTGGTENHLVLWDLPPLGLAGNSLETL | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 18,888.200 | ||
| Theoretical pI: | 6.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
| Instability index: | 36.322 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.267 | ||
| sheet | 0.290 | ||