| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341557.1 | 5prime_partial | 163 | 522-31(-) |
Amino Acid sequence : | |||
| TRKWIYNQQAESLGPASNSIVPAAPHLRRLNSTKSGSIVGNYLNDHDVEDLEMLLEAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNQRNELIQLQLTLTSASFSVAVETAIAGIFGM NIPCTLYNTDGIFWQAVALMTIVSVVLFILVWGYARWKKLLGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 18,360.761 | ||
| Theoretical pI: | 4.914 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32430 | ||
| Instability index: | 34.945 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.374 | ||
| turn | 0.221 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341557.1 | 5prime_partial | 163 | 522-31(-) |
Amino Acid sequence : | |||
| TRKWIYNQQAESLGPASNSIVPAAPHLRRLNSTKSGSIVGNYLNDHDVEDLEMLLEAYFMQLDGTRNKILSVREYIDDTEDYVNIQLDNQRNELIQLQLTLTSASFSVAVETAIAGIFGM NIPCTLYNTDGIFWQAVALMTIVSVVLFILVWGYARWKKLLGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 18,360.761 | ||
| Theoretical pI: | 4.914 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32430 | ||
| Instability index: | 34.945 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.374 | ||
| turn | 0.221 | ||
| sheet | 0.270 | ||