| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341559.1 | 5prime_partial | 182 | 3-551(+) |
Amino Acid sequence : | |||
| TPMEHVIKPVIPAKYLYDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTI PDKDILSLIKENFNFRPGMMAINLDLLRGGNFRYHKTAAYGHFGRDDPDFTWETVKILKPKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 19,849.623 | ||
| Theoretical pI: | 9.591 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 10.276 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.152 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.253 | ||
| sheet | 0.181 | ||