| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341562.1 | internal | 281 | 3-845(+) |
Amino Acid sequence : | |||
| TPFKSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVNDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAI NVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVC | |||
Physicochemical properties | |||
| Number of amino acids: | 281 | ||
| Molecular weight: | 28,317.421 | ||
| Theoretical pI: | 5.130 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.238 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.031 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.294 | ||
| sheet | 0.309 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341562.1 | 5prime_partial | 272 | 845-27(-) |
Amino Acid sequence : | |||
| THNSHLSGNHYISSPHKSIRQRVAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDAL VNQQRGITAVVDDEIGAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELD FEAAEVGLGHVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 28,317.421 | ||
| Theoretical pI: | 5.130 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.238 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.031 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.294 | ||
| sheet | 0.309 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341562.1 | internal | 281 | 3-845(+) |
Amino Acid sequence : | |||
| TPFKSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVNDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAI NVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVC | |||
Physicochemical properties | |||
| Number of amino acids: | 281 | ||
| Molecular weight: | 28,317.421 | ||
| Theoretical pI: | 5.130 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.238 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.031 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.294 | ||
| sheet | 0.309 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341562.1 | 5prime_partial | 272 | 845-27(-) |
Amino Acid sequence : | |||
| THNSHLSGNHYISSPHKSIRQRVAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDAL VNQQRGITAVVDDEIGAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELD FEAAEVGLGHVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 28,317.421 | ||
| Theoretical pI: | 5.130 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.238 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.031 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.294 | ||
| sheet | 0.309 | ||