| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341571.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| ARPLYTLSATMPSVPGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTARNPDDPKNSHLRELEGADERLILCRADLNVYESLREAINGCDGVFHTASPVTDDPEQMVEPEVEGAKNVIRAA AEAKVRRVVLTSSIGAIYMDPNRDPDKVVDETCWSDLEFCKSTKNWYCYGKAVAEQAAWETAREVGVDLVVLKPVLVLGSLLQPTVNASVLHILKYLIGSAKTYANSIQAYVDVKDVALA HILLFENPAASGRYL | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 27,791.543 | ||
| Theoretical pI: | 5.485 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37275 | ||
| Instability index: | 25.798 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.000 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.212 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341571.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| ARPLYTLSATMPSVPGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTARNPDDPKNSHLRELEGADERLILCRADLNVYESLREAINGCDGVFHTASPVTDDPEQMVEPEVEGAKNVIRAA AEAKVRRVVLTSSIGAIYMDPNRDPDKVVDETCWSDLEFCKSTKNWYCYGKAVAEQAAWETAREVGVDLVVLKPVLVLGSLLQPTVNASVLHILKYLIGSAKTYANSIQAYVDVKDVALA HILLFENPAASGRYL | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 27,791.543 | ||
| Theoretical pI: | 5.485 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37275 | ||
| Instability index: | 25.798 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.000 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.212 | ||
| sheet | 0.294 | ||