| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341581.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| TTLYIHSDQHRKGVTLREREMASCGALRTTFLPSLLHSHRTTAALPTKTQKFSVGAALQHDNTNDISSVASQEPKPLTFTGERPSTPILDTINFPNHMKNLSIQELEKLCDELREEIVYT VSKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRQTFGLAGFPKRDESAHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQAYE ALNNAGFLDANLIVVLNDNKQ | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 28,453.710 | ||
| Theoretical pI: | 6.924 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 36.610 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.253 | ||
| sheet | 0.249 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341581.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| TTLYIHSDQHRKGVTLREREMASCGALRTTFLPSLLHSHRTTAALPTKTQKFSVGAALQHDNTNDISSVASQEPKPLTFTGERPSTPILDTINFPNHMKNLSIQELEKLCDELREEIVYT VSKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRQTFGLAGFPKRDESAHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQAYE ALNNAGFLDANLIVVLNDNKQ | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 28,453.710 | ||
| Theoretical pI: | 6.924 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 36.610 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.332 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.253 | ||
| sheet | 0.249 | ||