| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341591.1 | 5prime_partial | 211 | 678-43(-) |
Amino Acid sequence : | |||
| HGGAHAQEPLPLTDGSRPECKPDIQPKFTPTIELLPGDGIAPFGFELLARSMDDPAQDQNPARILRVIMEIFQAAGSQGLIAGLYKEAEIVDPLSRFGFVEYVCRKKSGEIPGCGAACGP ILPGGPDEEIEKLGNFGLCAGTMRALMEVGNTPEIEKIVRRLKDLALKEMEGFPGEKPALMSTLVAEPSRPVTRWGIKEMYLCCDPDKLTP* | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 15,886.797 | ||
| Theoretical pI: | 10.009 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 51.278 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.421 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341591.1 | 5prime_partial | 153 | 2-463(+) |
Amino Acid sequence : | |||
| TGXFIQHKTLFSNIHGVNLSGSQHKYISLIPQRVTGRLGSATRVDISAGFSPGKPSISLRAKSFNLLTIFSISGVFPTSINALIVPAQSPKFPSFSISSSGPPGNMGPQAAPQPGISPDF FRHTYSTNPNLESGSTISASLYSPAISPCEPAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 15,886.797 | ||
| Theoretical pI: | 10.009 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 51.278 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.421 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341591.1 | 5prime_partial | 211 | 678-43(-) |
Amino Acid sequence : | |||
| HGGAHAQEPLPLTDGSRPECKPDIQPKFTPTIELLPGDGIAPFGFELLARSMDDPAQDQNPARILRVIMEIFQAAGSQGLIAGLYKEAEIVDPLSRFGFVEYVCRKKSGEIPGCGAACGP ILPGGPDEEIEKLGNFGLCAGTMRALMEVGNTPEIEKIVRRLKDLALKEMEGFPGEKPALMSTLVAEPSRPVTRWGIKEMYLCCDPDKLTP* | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 15,886.797 | ||
| Theoretical pI: | 10.009 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 51.278 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.421 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341591.1 | 5prime_partial | 153 | 2-463(+) |
Amino Acid sequence : | |||
| TGXFIQHKTLFSNIHGVNLSGSQHKYISLIPQRVTGRLGSATRVDISAGFSPGKPSISLRAKSFNLLTIFSISGVFPTSINALIVPAQSPKFPSFSISSSGPPGNMGPQAAPQPGISPDF FRHTYSTNPNLESGSTISASLYSPAISPCEPAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 15,886.797 | ||
| Theoretical pI: | 10.009 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 51.278 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.421 | ||
| sheet | 0.158 | ||