| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341602.1 | internal | 194 | 3-584(+) |
Amino Acid sequence : | |||
| SSPPPPAAPAYPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPT AFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAAMLLWVLHD | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 21,069.034 | ||
| Theoretical pI: | 8.733 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 34.998 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.268 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341602.1 | internal | 194 | 3-584(+) |
Amino Acid sequence : | |||
| SSPPPPAAPAYPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPT AFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAAMLLWVLHD | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 21,069.034 | ||
| Theoretical pI: | 8.733 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 34.998 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.268 | ||
| sheet | 0.284 | ||