| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341611.1 | 5prime_partial | 117 | 494-141(-) |
Amino Acid sequence : | |||
| TRGRMQDNEPLMRALSKLIYVNNPDLVLFVGEALVGNDAVDQLSKFNQKLGDLSPSPDPRLIDGILLTKFDTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,769.769 | ||
| Theoretical pI: | 7.715 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 10.588 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341611.1 | 5prime_partial | 117 | 494-141(-) |
Amino Acid sequence : | |||
| TRGRMQDNEPLMRALSKLIYVNNPDLVLFVGEALVGNDAVDQLSKFNQKLGDLSPSPDPRLIDGILLTKFDTIDDKVGAALSMVYISGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,769.769 | ||
| Theoretical pI: | 7.715 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 10.588 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||