| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341637.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| NPPQQAANFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRSVR VSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLSVFPEPMVPSKVHIFMYGLLIGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMRELVMQTDY | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,574.300 | ||
| Theoretical pI: | 6.110 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 43890 | ||
| Instability index: | 30.572 | ||
| aromaticity | 0.134 | ||
| GRAVY | -0.128 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.261 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341637.1 | internal | 238 | 2-715(+) |
Amino Acid sequence : | |||
| NPPQQAANFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRSVR VSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLSVFPEPMVPSKVHIFMYGLLIGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMRELVMQTDY | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,574.300 | ||
| Theoretical pI: | 6.110 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 43890 | ||
| Instability index: | 30.572 | ||
| aromaticity | 0.134 | ||
| GRAVY | -0.128 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.261 | ||
| sheet | 0.269 | ||