Acc_NO	ORF type	length	start-end position (strand +/-)
>DY341649.1	complete	130	89-481(+)
Amino Acid sequence :
MSAYENVVGGKLRLKGKALDVRGTGIKKRKKHRERNLTSYHASGHDQLTDENDVLTTDGRYLDGNWNGEEYEADERLTLAERRYMERLQKIELERLAKAAKKSHRDRIQEFNRYLANLSE HYDIPKVGPG*
Physicochemical properties
Number of amino acids:		130
Molecular weight:		15,099.739
Theoretical pI:		9.270
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15930 15930
Instability index:		28.171
aromaticity		0.069
GRAVY		-1.143
Secondary Structure Fraction
Helix		0.246
turn		0.192
sheet		0.292