| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341653.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
| NXSLHKHTKMAKPAASAAARFPSIDKCDLSASNRHSIAADLDGTLLISRSSFPYFMLVAIEAGSLLRGFFLLLAFPLIAIAYIFVSEALAIQMLIYISFAGLKVRDIELASRAVLPRFYA SDVRPESFAVFDKCKRKVIITANPTIMVEPFVKDYLGGDKVIGTEIEVDPKTRKATGFVKKPGVLVGEWKKLGVLKEFGDERPDIGIGDRESDHDFMSICKEGYMVPPSKTAKPLPMDRL KSRLIFHDGRLVQRPTPATA | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 11,411.055 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 73.785 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.400 | ||
| sheet | 0.133 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341653.1 | 5prime_partial | 138 | 1-417(+) |
Amino Acid sequence : | |||
| RTXLSTNIQKWLNPPLPQRRASLPSTNATSPPQTATPLRRTSTEPSSSPVPPSLTSCSSRSRPAASFAASSSSSPSPSSPLPTSSSPKPSPSRCSSTSPSPDSRSATSSWPPAPCCRGST PATSGRRASPSSISARGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 11,411.055 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 73.785 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.400 | ||
| sheet | 0.133 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341653.1 | complete | 106 | 80-400(+) |
Amino Acid sequence : | |||
| MRPLRLKPPLHCGGPRRNPPHLPFLLPLLHARRDRGRQPPSRLLPPPRLPPHRHCLHLRLRSPRHPDAHLHLLRRTQGPRHRAGLPRRAAAVLRQRRQAGELRRLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,411.055 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 73.785 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.400 | ||
| sheet | 0.133 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341653.1 | 5prime_partial | 105 | 781-464(-) |
Amino Acid sequence : | |||
| AVAGVGRWTRRPSWKIRRLFRRSIGSGFAVLLGGTMYPSLQIDMKSWSDSRSPIPISGLSSPNSLSTPNFFHSPTKTPGFFTNPVAFLVFGSTSISVPITLSPPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,411.055 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 73.785 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.400 | ||
| sheet | 0.133 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341653.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
| NXSLHKHTKMAKPAASAAARFPSIDKCDLSASNRHSIAADLDGTLLISRSSFPYFMLVAIEAGSLLRGFFLLLAFPLIAIAYIFVSEALAIQMLIYISFAGLKVRDIELASRAVLPRFYA SDVRPESFAVFDKCKRKVIITANPTIMVEPFVKDYLGGDKVIGTEIEVDPKTRKATGFVKKPGVLVGEWKKLGVLKEFGDERPDIGIGDRESDHDFMSICKEGYMVPPSKTAKPLPMDRL KSRLIFHDGRLVQRPTPATA | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 11,411.055 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 73.785 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.400 | ||
| sheet | 0.133 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341653.1 | 5prime_partial | 138 | 1-417(+) |
Amino Acid sequence : | |||
| RTXLSTNIQKWLNPPLPQRRASLPSTNATSPPQTATPLRRTSTEPSSSPVPPSLTSCSSRSRPAASFAASSSSSPSPSSPLPTSSSPKPSPSRCSSTSPSPDSRSATSSWPPAPCCRGST PATSGRRASPSSISARGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 11,411.055 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 73.785 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.400 | ||
| sheet | 0.133 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341653.1 | complete | 106 | 80-400(+) |
Amino Acid sequence : | |||
| MRPLRLKPPLHCGGPRRNPPHLPFLLPLLHARRDRGRQPPSRLLPPPRLPPHRHCLHLRLRSPRHPDAHLHLLRRTQGPRHRAGLPRRAAAVLRQRRQAGELRRLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,411.055 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 73.785 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.400 | ||
| sheet | 0.133 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341653.1 | 5prime_partial | 105 | 781-464(-) |
Amino Acid sequence : | |||
| AVAGVGRWTRRPSWKIRRLFRRSIGSGFAVLLGGTMYPSLQIDMKSWSDSRSPIPISGLSSPNSLSTPNFFHSPTKTPGFFTNPVAFLVFGSTSISVPITLSPPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,411.055 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 73.785 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.400 | ||
| sheet | 0.133 | ||