Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341657.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
IELEIPDILHNPVRKLSLSALSSAVGLPPDHLHRIMRFLAHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGPFVLLQGAQRGPSACITAQGLKSRERPGVEELGSDPLYEDPIFTEK VFRDAMTCHARVTTSAVIENYGEGFRGVGSLVDVGGSYG | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 17,164.187 | ||
Theoretical pI: | 6.067 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
Instability index: | 41.455 | ||
aromaticity | 0.069 | ||
GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.283 | ||
sheet | 0.258 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341657.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
IELEIPDILHNPVRKLSLSALSSAVGLPPDHLHRIMRFLAHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGPFVLLQGAQRGPSACITAQGLKSRERPGVEELGSDPLYEDPIFTEK VFRDAMTCHARVTTSAVIENYGEGFRGVGSLVDVGGSYG | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 17,164.187 | ||
Theoretical pI: | 6.067 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
Instability index: | 41.455 | ||
aromaticity | 0.069 | ||
GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.283 | ||
sheet | 0.258 |