| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341664.1 | 3prime_partial | 182 | 91-636(+) |
Amino Acid sequence : | |||
| MRGEERTVETSPSWSGGILDFWDDISLAYLSLFCSFCVFGWNMERLGFGNMYVHIATFLLFCMAPFWIFNLAAVNIDNETVREALGVTGIFLCVFGLLYGGFWRIQMRKRFHLPPYKFCC GKPAVTDCALWLFCCWCTLAQEVRTGNAYDIVEDKLCKKQGDEQLPISPLNREDGEFQLRSR | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 20,964.128 | ||
| Theoretical pI: | 5.416 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45950 46575 | ||
| Instability index: | 45.401 | ||
| aromaticity | 0.154 | ||
| GRAVY | 0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.203 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341664.1 | 3prime_partial | 182 | 91-636(+) |
Amino Acid sequence : | |||
| MRGEERTVETSPSWSGGILDFWDDISLAYLSLFCSFCVFGWNMERLGFGNMYVHIATFLLFCMAPFWIFNLAAVNIDNETVREALGVTGIFLCVFGLLYGGFWRIQMRKRFHLPPYKFCC GKPAVTDCALWLFCCWCTLAQEVRTGNAYDIVEDKLCKKQGDEQLPISPLNREDGEFQLRSR | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 20,964.128 | ||
| Theoretical pI: | 5.416 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45950 46575 | ||
| Instability index: | 45.401 | ||
| aromaticity | 0.154 | ||
| GRAVY | 0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.203 | ||
| sheet | 0.253 | ||