| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341666.1 | 5prime_partial | 172 | 654-136(-) |
Amino Acid sequence : | |||
| LFKVDSFLEKIRGPLSQGQLQLISTNPNDNPSVTFNYFQHPLDLQRCVDGLSIIEKVVESKAFTTFRYDYQSLPILLNMTANAPINLFPHHTNVSTSLEQFCRDTVMTIWHYHGGCQLGR VVDSDFRVLGVDRLRVIDGSPFHDSPGTNPQATVMMLGRYMGVQIMKERLIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 19,544.183 | ||
| Theoretical pI: | 6.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 34.252 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.250 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341666.1 | 5prime_partial | 172 | 654-136(-) |
Amino Acid sequence : | |||
| LFKVDSFLEKIRGPLSQGQLQLISTNPNDNPSVTFNYFQHPLDLQRCVDGLSIIEKVVESKAFTTFRYDYQSLPILLNMTANAPINLFPHHTNVSTSLEQFCRDTVMTIWHYHGGCQLGR VVDSDFRVLGVDRLRVIDGSPFHDSPGTNPQATVMMLGRYMGVQIMKERLIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 19,544.183 | ||
| Theoretical pI: | 6.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 34.252 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.250 | ||
| sheet | 0.192 | ||