Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341677.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
TPCISIQFISCVQLPLPEMGLFRRRPPLSVRCSTDSSLPLTVESSDFDAKVFRHNFMRRKDYNRKGFGHEEESLQRISHQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWGVERAL RIAYEARKQFPTQNIWLTSEIIHNPTVNQRLKEMGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKNVEVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVATAS FAGNYIV | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 28,139.794 | ||
Theoretical pI: | 7.643 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39670 | ||
Instability index: | 45.019 | ||
aromaticity | 0.093 | ||
GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.219 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341677.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
TPCISIQFISCVQLPLPEMGLFRRRPPLSVRCSTDSSLPLTVESSDFDAKVFRHNFMRRKDYNRKGFGHEEESLQRISHQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWGVERAL RIAYEARKQFPTQNIWLTSEIIHNPTVNQRLKEMGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKNVEVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVATAS FAGNYIV | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 28,139.794 | ||
Theoretical pI: | 7.643 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39670 | ||
Instability index: | 45.019 | ||
aromaticity | 0.093 | ||
GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.219 | ||
sheet | 0.227 |