| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341679.1 | internal | 161 | 484-2(-) |
Amino Acid sequence : | |||
| RNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLEWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQ AMSLVFVVMAGGVSAPATGYYMVAMAVLSFLASKWLSHFIH | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 18,480.128 | ||
| Theoretical pI: | 8.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40700 | ||
| Instability index: | 62.375 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.205 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341679.1 | internal | 161 | 484-2(-) |
Amino Acid sequence : | |||
| RNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLEWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQ AMSLVFVVMAGGVSAPATGYYMVAMAVLSFLASKWLSHFIH | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 18,480.128 | ||
| Theoretical pI: | 8.745 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40700 | ||
| Instability index: | 62.375 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.205 | ||
| sheet | 0.255 | ||