Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341687.1 | 5prime_partial | 145 | 3-440(+) |
Amino Acid sequence : | |||
NLEVPSKPNYSLVLYFAADKPVIKDSLLGKFVDGNDMYRDSRFKLIPSITEGYWMVKRAVGTKACLLGKAVTCNYLRQDNFLEIDVDIGSSSVARGVIGLVLGYVTSIVVDLAIVIEAKE EAELPEFILGTVRLNRVELDSAVAL* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 15,927.316 | ||
Theoretical pI: | 5.003 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 30.407 | ||
aromaticity | 0.083 | ||
GRAVY | 0.288 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.214 | ||
sheet | 0.276 |