Acc_NO	ORF type	length	start-end position (strand +/-)
>DY341700.1	5prime_partial	259	2-781(+)
Amino Acid sequence :
HAVRPVTGRAADVIAPANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSTSGPDTRVDDAEFEENEVYAIDIVASTGEGKPKLLDEKQTTIYKRA VDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIKLTVLLMPNGSDRVTSHPLQELQPTKTVDDPEIKSWLALATKTKKKGGGKKK IAKKGDKSEEVAADADAAE*
Physicochemical properties
Number of amino acids:		259
Molecular weight:		28,399.358
Theoretical pI:		8.834
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		35.893
aromaticity		0.046
GRAVY		-0.395
Secondary Structure Fraction
Helix		0.270
turn		0.181
sheet		0.286