| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341719.1 | internal | 215 | 646-2(-) |
Amino Acid sequence : | |||
| GIGSLNFVMGNKLAVLAGDFLLSRACVALASLKNTEVVTLLAKVVEHLVTGETMQMTTTSDQRCSMEYYMQKTYYKTASLISNSCKAIGLLAGQSAEVSTLAYEYGKNLGLAFQLIDDLL DFTGTSSSLGKGSLSDIRHGIITAPILFAMEEYPELRAVVDRGFDNPANVDLALEYLSKSSGIQRTRELATKHARLAADAIDALPENNDEVVQRS | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 23,236.249 | ||
| Theoretical pI: | 5.105 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
| Instability index: | 22.522 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.047 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.219 | ||
| sheet | 0.330 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341719.1 | internal | 215 | 646-2(-) |
Amino Acid sequence : | |||
| GIGSLNFVMGNKLAVLAGDFLLSRACVALASLKNTEVVTLLAKVVEHLVTGETMQMTTTSDQRCSMEYYMQKTYYKTASLISNSCKAIGLLAGQSAEVSTLAYEYGKNLGLAFQLIDDLL DFTGTSSSLGKGSLSDIRHGIITAPILFAMEEYPELRAVVDRGFDNPANVDLALEYLSKSSGIQRTRELATKHARLAADAIDALPENNDEVVQRS | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 23,236.249 | ||
| Theoretical pI: | 5.105 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
| Instability index: | 22.522 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.047 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.219 | ||
| sheet | 0.330 | ||