| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341726.1 | complete | 132 | 479-81(-) |
Amino Acid sequence : | |||
| MAAASNSIIMERNTPSESVCREYEDLLPVMVDKLDGDPFVAELCGGFRLLADPSKGLITAASLQKNCALLGLDGMSREEAEAMVQEGDLVGDGALTQTEFCILMVSLSPPMMEDAQTWLA KAIQPELQRPSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,868.535 | ||
| Theoretical pI: | 8.945 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 36.946 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.557 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.256 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341726.1 | 5prime_partial | 125 | 3-380(+) |
Amino Acid sequence : | |||
| NHRIDEKKIYNPGLNMMDASITHRIKSRRGSLQLGLNGFGEPSLSIFHHGRAKADHQDAEFGLGERSIADEIAFLNHGFRLLSAHPIQPQKSTILLEACRRDQPLAGIGQKPETTAQLRH EGVSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,868.535 | ||
| Theoretical pI: | 8.945 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 36.946 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.557 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.256 | ||
| sheet | 0.264 | ||